Microsoft Outlook Express inbox repair tool download permits opening damaged DBX files of any version and size. Try Outlook Express Repair Toolbox if you encounter data corruption problems and evaluate Microsoft Outlook Express 6 repair tool.
Traffic Report and Web Analysis for Outlookexpressrepairtoolbox - outlookexpressrepairtoolbox.com
3.48 Rating by StatMemory
Outlookexpressrepairtoolbox is 11 years 6 months old. It is
estimated worth of $10 and have a daily income of around $5 advertisement revenue per month.
As no active threats were reported recently by users, outlookexpressrepairtoolbox.com is SAFE to browse.
Please note, that we are not promoting, or affiliated with outlookexpressrepairtoolbox.com in any way. We are just displaying outlookexpressrepairtoolbox.com public data & statistics for analysis purposes.
Google Page Speed
Estimated worth
$ 10
Alexa Rank
0
Country Host
Finland
Estimated Data Report
# | Estimated Pageviews | Estimated Unique Visitors | Estimated Ad Income |
---|---|---|---|
Daily | 1 | 0 | $ 0 |
Monthly | 40 | 1 | $ 5 |
Yearly | 480 | 12 | $ 60 |
General Information
Meta Tags | Info |
---|---|
Title | Microsoft Outlook Express repair tool 2003 opens damaged DBX files |
Description | Microsoft Outlook Express inbox repair tool download permits opening damaged DBX files of any version and size. Try Outlook Express Repair Toolbox if you encounter data corruption problems and evaluate Microsoft Outlook Express 6 repair tool. |
Keywords | Microsoft Outlook Express Repair tool 2003, Microsoft Outlook Express inbox Repair tool download, Microsoft Outlook Express 6 Repair tool, How to download Outlook Express Repair tools, xp Microsoft Outlook Express 6 inbox Repair tool |
Language | English |
HTTP Header | |
Important Html Tags |
|
Domain Age | 11 years 6 months |
Server Response | 0.3907 Sec |
Page Resources Breakdown
HTML Elements Analysis
Website Traffic Information
# | Stats |
---|---|
Alexa Global Rank | Not Applicable |
Popularity at | Not Applicable |
Regional Rank | Not Applicable |
Traffic Rank
Search Engine Traffic
Backlink History
Referring Domains
Outlookexpressrepairtoolbox Similar Sites
Microsoft Outlook Express repair tool 2003 opens damaged DBX filesmdfrepair.sqlserverrepairtoolbox.comMicrosoft Outlook Express inbox repair tool download permits opening damaged DBX files of any version and size. Try Outlook Express Repair Toolbox if you encounter data corruption problems and evaluate Microsoft Outlook Express 6 repair tool |
Microsoft Outlook Inbox repair tool | Microsoft Outlook recovery software | Recover Outlook emails tool | Fix pst filesoutlookrecovery.oemailrecovery.comOutlook Recovery (Outlook Repair) tool. Outlook Recovery Toolbox is a software product for restoring destroyed or damaged PST files of Microsoft Outlook mail client, recovering Outlook emails, recover Outlook emails. Microsoft Outlook Inbox repair tool. F |
How to repair empty Outlook Express folders?outlookexpress.repairtoolbox.comMicrosoft Outlook Express repair tool. Outlook Express Repair Toolbox helps to repair dbx file in Outlook Express in few clicks. |
How to repair damaged MS Outlook Personal Foldersrepairoutlook.recoverytoolbox.comMicrosoft Outlook Repair Tool for corrupted pst files. How to repair bad Microsoft Outlook storage files (*.pst, *.ost) with the help of Recovery Toolbox for Outlook? |
How to repair an incorrect DBX file of Outlook Express?repairoutlookexpress.recoverytoolbox.comOutlook Express DBX Repair Tool helps to fix corrupted *.DBX files. Recovery Toolbox for Outlook Express can repair an Outlook Express folder if it looks empty. |
Host Information
Domain IP | 95.216.69.194 |
Country | Finland |
ISP | GoDaddy.com, LLC |
Domain Nameserver Information
Host | IP Address | Country |
---|---|---|
ns47.domaincontrol.com | 97.74.103.24 | Finland |
ns48.domaincontrol.com | 173.201.71.24 | Finland |
Server IP Blacklist/NOT
Blacklist means involved in spamming or other unwanted online behavior, on your server IP address.
Malware detection
Services | Stats |
---|---|
Safe Browsing | Good (Safe Site) |
Antivirus Check | Good |
WHOIS Information
Domain Name: OUTLOOKEXPRESSREPAIRTOOLBOX.COM Registry Domain ID: 1755609651_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2018-09-18T05:32:47Z Creation Date: 2012-10-29T15:52:13Z Registry Expiry Date: 2020-10-29T15:52:13Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: 480-624-2505 Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Name Server: NS47.DOMAINCONTROL.COM Name Server: NS48.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of whois database: 2019-09-17T03:48:06Z <<< For more information on Whois status codes, please visit https://icann.org/epp NOTICE: The expiration date displayed in this record is the date the registrar's sponsorship of the domain name registration in the registry is currently set to expire. This date does not necessarily reflect the expiration date of the domain name registrant's agreement with the sponsoring registrar. Users may consult the sponsoring registrar's Whois database to view the registrar's reported date of expiration for this registration. TERMS OF USE: You are not authorized to access or query our Whois database through the use of electronic processes that are high-volume and automated except as reasonably necessary to register domain names or modify existing registrations; the Data in VeriSign Global Registry Services' ("VeriSign") Whois database is provided by VeriSign for information purposes only, and to assist persons in obtaining information about or related to a domain name registration record. VeriSign does not guarantee its accuracy. By submitting a Whois query, you agree to abide by the following terms of use: You agree that you may use this Data only for lawful purposes and that under no circumstances will you use this Data to: (1) allow, enable, or otherwise support the transmission of mass unsolicited, commercial advertising or solicitations via e-mail, telephone, or facsimile; or (2) enable high volume, automated, electronic processes that apply to VeriSign (or its computer systems). The compilation, repackaging, dissemination or other use of this Data is expressly prohibited without the prior written consent of VeriSign. You agree not to use electronic processes that are automated and high-volume to access or query the Whois database except as reasonably necessary to register domain names or modify existing registrations. VeriSign reserves the right to restrict your access to the Whois database in its sole discretion to ensure operational stability. VeriSign may restrict or terminate your access to the Whois database for failure to abide by these terms of use. VeriSign reserves the right to modify these terms at any time. The Registry database contains ONLY .COM, .NET, .EDU domains and Registrars.
Host Information
Registrar | GoDaddy.com, LLC |
Creation Date | 12 years ago 2012-10-29 |
Updated Date | 6 years ago 2018-09-18 |
Expiry Date | 2020-10-29 |
Status | clientDeleteProhibited clientRenewProhibited clientTransferProhibited clientUpdateProhibited |